(data stored in ACNUC7421 zone)

HOGENOMDNA: ACISJ_3.PE5

ACISJ_3.PE5          Location/Qualifiers
FT   CDS             5262..6233
FT                   /locus_tag="Ajs_0005"
FT                   /gene_family="HOG000126605" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   reu:Reut_A1420 twin-arginine translocation pathway signal"
FT                   /db_xref="GI:121592441"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:4671332"
FT                   /translation="MTHALLNRRTLSLLLAAGCVAGPALAQPERFPSRPIKVLIGFTAG
FT                   GSTDVPFRVLAENASKILGQPVIIENKPGAGGVLPAQMMQSTPADGYTLAQVPLPVFRL
FT                   PYTQKINWNPATDLQYVIGLAGYAFGLVVPADSPIKSMQDYIAYAKNNPGKLNYGTPGA
FT                   LTTLHLTMENIALQAGVTLNHIPYKGNSESLQAVLGGHVMSIADTPGWAPYVEQGKLRV
FT                   LSVWGDKRSARFPNVPTLKEVGINLVQTSPFGLVVPKGTDPKITQVLHDAFKKAMEMPN
FT                   YKESLAKFDMDTYYMDSATYKQYALDTMKTEKVIIEKLGLAK"
FT                   /protein_id="YP_984337.1"
     MTHALLNRRT LSLLLAAGCV AGPALAQPER FPSRPIKVLI GFTAGGSTDV PFRVLAENAS        60
     KILGQPVIIE NKPGAGGVLP AQMMQSTPAD GYTLAQVPLP VFRLPYTQKI NWNPATDLQY       120
     VIGLAGYAFG LVVPADSPIK SMQDYIAYAK NNPGKLNYGT PGALTTLHLT MENIALQAGV       180
     TLNHIPYKGN SESLQAVLGG HVMSIADTPG WAPYVEQGKL RVLSVWGDKR SARFPNVPTL       240
     KEVGINLVQT SPFGLVVPKG TDPKITQVLH DAFKKAMEMP NYKESLAKFD MDTYYMDSAT       300
     YKQYALDTMK TEKVIIEKLG LAK                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page