(data stored in ACNUC7421 zone)

HOGENOMDNA: ACISJ_3.PE6

ACISJ_3.PE6          Location/Qualifiers
FT   CDS             complement(6572..7177)
FT                   /locus_tag="Ajs_0006"
FT                   /gene_family="HOG000224876" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_A1159 hypothetical protein"
FT                   /db_xref="GI:121592442"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="GeneID:4671272"
FT                   /translation="MPTIARRSAFFRRTALLSPVPFLAAAAACLTAPPALAQPSEDRAY
FT                   APSVYVQGEWARRQTDAITIGATLPWGTWRRPLWGGELRGHWDVSLSRWSFDGIGGHNS
FT                   AVVVGVAPTLRLRPDEGRSPWFWEAGIGATVASHRYRVQDHEFSTRFNFASHLGLGRNF
FT                   GAQRQHELMLSVQHVSNAGIKSPNPGENFLQLRYALHF"
FT                   /protein_id="YP_984338.1"
     MPTIARRSAF FRRTALLSPV PFLAAAAACL TAPPALAQPS EDRAYAPSVY VQGEWARRQT        60
     DAITIGATLP WGTWRRPLWG GELRGHWDVS LSRWSFDGIG GHNSAVVVGV APTLRLRPDE       120
     GRSPWFWEAG IGATVASHRY RVQDHEFSTR FNFASHLGLG RNFGAQRQHE LMLSVQHVSN       180
     AGIKSPNPGE NFLQLRYALH F                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page