(data stored in ACNUC7421 zone)

HOGENOMDNA: ACISJ_3.PE7

ACISJ_3.PE7          Location/Qualifiers
FT   CDS             complement(7318..7947)
FT                   /locus_tag="Ajs_0007"
FT                   /gene_family="HOG000220307" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pol:Bpro_0029 hypothetical protein"
FT                   /db_xref="GI:121592443"
FT                   /db_xref="GeneID:4671717"
FT                   /translation="MARFKITQRLAATAVAAAVLAGMAVPTLAQPGPGPAATEQGASQA
FT                   QQRPRQRALTPEQREQYMAQRAEAFKRKLQLTPEQEPAWNSFLQSMKPDADARKARLDW
FT                   QGMDQLTTPERIDRMRALRSQRAAEMDRRGDAVKAFYGTLTPAQQKTFDAEGKRMYRHW
FT                   GGDHPMGKRWGKDGARGDFRGDGRGMRHQGPGPGAGAAPGAPLTPQ"
FT                   /protein_id="YP_984339.1"
     MARFKITQRL AATAVAAAVL AGMAVPTLAQ PGPGPAATEQ GASQAQQRPR QRALTPEQRE        60
     QYMAQRAEAF KRKLQLTPEQ EPAWNSFLQS MKPDADARKA RLDWQGMDQL TTPERIDRMR       120
     ALRSQRAAEM DRRGDAVKAF YGTLTPAQQK TFDAEGKRMY RHWGGDHPMG KRWGKDGARG       180
     DFRGDGRGMR HQGPGPGAGA APGAPLTPQ                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page