(data stored in ACNUC30630 zone)

EMBL: AE000513.PE111

AE000513.PE111       Location/Qualifiers
FT   CDS             complement(111973..112995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0113"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="similar to SP:P32573 PID:1302205 PID:553143
FT                   PID:600063 percent identity: 62.84; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09705"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY38"
FT                   /protein_id="AAF09705.1"
FT                   /translation="MDGVYKGKPFLCWKRLFCLGRHSVYLRRLFGIGRCSTLSGRFHSR
FT                   PFHVPTPRRFSMTQSSPNRPADPATTFRPDLLAGKHALITGGGSGINLGIAQSFAAHGC
FT                   AVTILGRNLEKAQNAAQGIVDAGGRAMGVSADVRDFAALEAAVAAATAEFGDFDIVLAG
FT                   AAGNFPAPVDGISPNGFKTVVDIDLLGTYNTIKAAAPRLKVPGGNILSISAYGVPVPMQ
FT                   AHVVAAKAGVDALTQTLAVEWGLRGVRVNAIIPGPIDGTEGMARLAPDEKSRSAFTRTV
FT                   PLGRFGVPQDIANAALFLVSDAASYVTGVILPVDGGQNMLGGAPQYQMYLQMQAAQQKD
FT                   "
     MDGVYKGKPF LCWKRLFCLG RHSVYLRRLF GIGRCSTLSG RFHSRPFHVP TPRRFSMTQS        60
     SPNRPADPAT TFRPDLLAGK HALITGGGSG INLGIAQSFA AHGCAVTILG RNLEKAQNAA       120
     QGIVDAGGRA MGVSADVRDF AALEAAVAAA TAEFGDFDIV LAGAAGNFPA PVDGISPNGF       180
     KTVVDIDLLG TYNTIKAAAP RLKVPGGNIL SISAYGVPVP MQAHVVAAKA GVDALTQTLA       240
     VEWGLRGVRV NAIIPGPIDG TEGMARLAPD EKSRSAFTRT VPLGRFGVPQ DIANAALFLV       300
     SDAASYVTGV ILPVDGGQNM LGGAPQYQMY LQMQAAQQKD                             340
//

If you have problems or comments...

PBIL Back to PBIL home page