(data stored in ACNUC30630 zone)

EMBL: AE000513.PE112

AE000513.PE112       Location/Qualifiers
FT   CDS             complement(113219..113992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0114"
FT                   /product="enoyl-CoA hydratase, putative"
FT                   /note="similar to PID:1502424 GB:AL123456 percent identity:
FT                   55.46; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09706"
FT                   /db_xref="GOA:Q9RY37"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="PDB:4JOT"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY37"
FT                   /protein_id="AAF09706.1"
FT                   /translation="MTYQSIRLTQRPLSQDGTTQGGTVATLTLAAKMGSMGPAFWQEFP
FT                   QALSELGDARVLIVRGEQVFSAGLDVKSNGAAIVPALGKPDAFKAVVDEMHAVTEGLAA
FT                   LPMPVIAAVHGWCIGAGLELIAGADLRLCSQDARFSLPEVKLGITADLGGLQRLPHLIG
FT                   RGRTAHLALTGEAIDAATAERWGLVTEVLPDQDALFARAEALAEHLAALPAKALEGTKR
FT                   ALSDGLPHAESLAAAVRWNAEHMTVEALQAGMKKG"
     MTYQSIRLTQ RPLSQDGTTQ GGTVATLTLA AKMGSMGPAF WQEFPQALSE LGDARVLIVR        60
     GEQVFSAGLD VKSNGAAIVP ALGKPDAFKA VVDEMHAVTE GLAALPMPVI AAVHGWCIGA       120
     GLELIAGADL RLCSQDARFS LPEVKLGITA DLGGLQRLPH LIGRGRTAHL ALTGEAIDAA       180
     TAERWGLVTE VLPDQDALFA RAEALAEHLA ALPAKALEGT KRALSDGLPH AESLAAAVRW       240
     NAEHMTVEAL QAGMKKG                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page