(data stored in ACNUC30630 zone)

EMBL: AE000513.PE114

AE000513.PE114       Location/Qualifiers
FT   CDS             114893..115282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0116"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09712"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY35"
FT                   /protein_id="AAF09712.1"
FT                   /translation="MGAAYYSILQQNVGQMVRITAGNDQIYGGFGVRVTGDVALRGETP
FT                   GNSLSGAVTYRGTTGRFDGILGVGAGYNFKNASTFGELSIGVDYRVVDRVAIFAEARQH
FT                   YYFNGNINPNSRNLSSIAAGFKVRF"
     MGAAYYSILQ QNVGQMVRIT AGNDQIYGGF GVRVTGDVAL RGETPGNSLS GAVTYRGTTG        60
     RFDGILGVGA GYNFKNASTF GELSIGVDYR VVDRVAIFAE ARQHYYFNGN INPNSRNLSS       120
     IAAGFKVRF                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page