(data stored in ACNUC30630 zone)

EMBL: AE000513.PE118

AE000513.PE118       Location/Qualifiers
FT   CDS             complement(118232..119344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0120"
FT                   /product="smf protein"
FT                   /note="similar to PID:1652454 percent identity: 52.21;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09710"
FT                   /db_xref="GOA:Q9RY31"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY31"
FT                   /protein_id="AAF09710.1"
FT                   /translation="MTLPSPAAAHAELLALLTLRFTPGLGPRRIENLRRHFGSAEAALA
FT                   APLTELRRVEGLDSRSVAAIGGAKAAEEARAELNKAAERGVTLLGRGLPGYPAALEALG
FT                   DPPAVLWVRGAGGAELLAGLGTVPHSVGIVGTRAASPHALALTRTIAGELAAAGVLIVS
FT                   GLARGVDTAAHTAALEAASGEASSPTIGVLGSAVDVIYPRENHDLAGRMVVVSEYPLGT
FT                   GPAQHHFPSRNRVIAALSAGVLVVEGERKSGSLITATHALDCGRTVFAVPGRAGDPRAS
FT                   GPHALIRDGAVLTESAQDVLTELNWGLAPAPAVPDLPPEQARVLRALQTPATLDDLAAT
FT                   TGLSIPELQTALVMLQLQGLAYEVGGRWSR"
     MTLPSPAAAH AELLALLTLR FTPGLGPRRI ENLRRHFGSA EAALAAPLTE LRRVEGLDSR        60
     SVAAIGGAKA AEEARAELNK AAERGVTLLG RGLPGYPAAL EALGDPPAVL WVRGAGGAEL       120
     LAGLGTVPHS VGIVGTRAAS PHALALTRTI AGELAAAGVL IVSGLARGVD TAAHTAALEA       180
     ASGEASSPTI GVLGSAVDVI YPRENHDLAG RMVVVSEYPL GTGPAQHHFP SRNRVIAALS       240
     AGVLVVEGER KSGSLITATH ALDCGRTVFA VPGRAGDPRA SGPHALIRDG AVLTESAQDV       300
     LTELNWGLAP APAVPDLPPE QARVLRALQT PATLDDLAAT TGLSIPELQT ALVMLQLQGL       360
     AYEVGGRWSR                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page