(data stored in ACNUC30630 zone)

EMBL: AE000513.PE125

AE000513.PE125       Location/Qualifiers
FT   CDS             complement(125525..126190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0128"
FT                   /product="grpE protein"
FT                   /note="similar to SP:Q56236 PID:1449141 PID:1542949 percent
FT                   identity: 61.18; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09717"
FT                   /db_xref="GOA:Q9RY24"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RY24"
FT                   /protein_id="AAF09717.1"
FT                   /translation="MFTNPFGRKKDMSDDQKKNNQPDTEADNAENIKFAADDTELRAGD
FT                   ETDADFEMPEGFPEMDENMFGQVQEMMAKLERVDELEKENADLKNRLGRLASDFEGYRN
FT                   RTTIESAEAHDKGVSKAAEALMPVYDDIDRALSLSVDDAAKLVPGMQAVQNKVLTIFGT
FT                   LGLEATGREGEQFDPQWHEAIQVVAGDEDEKIVQTYQLGFKMGDRLVRPARVVVSRKG"
     MFTNPFGRKK DMSDDQKKNN QPDTEADNAE NIKFAADDTE LRAGDETDAD FEMPEGFPEM        60
     DENMFGQVQE MMAKLERVDE LEKENADLKN RLGRLASDFE GYRNRTTIES AEAHDKGVSK       120
     AAEALMPVYD DIDRALSLSV DDAAKLVPGM QAVQNKVLTI FGTLGLEATG REGEQFDPQW       180
     HEAIQVVAGD EDEKIVQTYQ LGFKMGDRLV RPARVVVSRK G                           221
//

If you have problems or comments...

PBIL Back to PBIL home page