(data stored in ACNUC30630 zone)

EMBL: AE000513.PE127

AE000513.PE127       Location/Qualifiers
FT   CDS             complement(128314..129480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0130"
FT                   /product="coproporphyrinogen III oxidase, putative"
FT                   /note="similar to SP:P54304 PID:1303805 GB:AL009126 percent
FT                   identity: 52.45; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09719"
FT                   /db_xref="GOA:Q9RY22"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY22"
FT                   /protein_id="AAF09719.1"
FT                   /translation="MTFSAPAPTQLDPVVRHLYVHVPFCPSICPYCDFHVLTRQAGLVE
FT                   RYLERLEQEAAELAAAYAVDLDTVYLGGGTPSFLRDHELRALVESVQRHLGWGRAENTL
FT                   EINPGTVSTERAALWRSLGFDRASVGVQSLDDATLKFLGRRHDARQARDAVSRLIAQDF
FT                   RVSGDLITAVPGQPLDSDIHGLVELGVGHVSAYTLTIEPGTEFARRGVQVDEDAEREGF
FT                   ERTEELLAGHGFSRYEVSNYARAGQESRHNLSYWQGKTYLGLGPGAAGHYPVPTPGADA
FT                   LTLRRTNPHLHDWLVGQQGETLLVDPHEYVTDALFMGLRLRRGLDLADLTRRSGVDVAG
FT                   RYGLVIERQVRLGLLEHSGTNLRATAQGWWVLNRIVREFMEVDAAETA"
     MTFSAPAPTQ LDPVVRHLYV HVPFCPSICP YCDFHVLTRQ AGLVERYLER LEQEAAELAA        60
     AYAVDLDTVY LGGGTPSFLR DHELRALVES VQRHLGWGRA ENTLEINPGT VSTERAALWR       120
     SLGFDRASVG VQSLDDATLK FLGRRHDARQ ARDAVSRLIA QDFRVSGDLI TAVPGQPLDS       180
     DIHGLVELGV GHVSAYTLTI EPGTEFARRG VQVDEDAERE GFERTEELLA GHGFSRYEVS       240
     NYARAGQESR HNLSYWQGKT YLGLGPGAAG HYPVPTPGAD ALTLRRTNPH LHDWLVGQQG       300
     ETLLVDPHEY VTDALFMGLR LRRGLDLADL TRRSGVDVAG RYGLVIERQV RLGLLEHSGT       360
     NLRATAQGWW VLNRIVREFM EVDAAETA                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page