(data stored in ACNUC30630 zone)

EMBL: AE000513.PE133

AE000513.PE133       Location/Qualifiers
FT   CDS             complement(134747..135130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL009126 percent identity: 55.24;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09726"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY16"
FT                   /protein_id="AAF09726.1"
FT                   /translation="MGRFFCQHAGMTGPQIQIFGTKKSTATRAAERFFKERGVKVHFVD
FT                   VSAKPMSKGELTRFVQKFGVNALLDTEGKAYERANLAYLRTTEDSVVAKMLDDPALLRL
FT                   PLVRGGKVLSVGEDQEAWGKMLE"
     MGRFFCQHAG MTGPQIQIFG TKKSTATRAA ERFFKERGVK VHFVDVSAKP MSKGELTRFV        60
     QKFGVNALLD TEGKAYERAN LAYLRTTEDS VVAKMLDDPA LLRLPLVRGG KVLSVGEDQE       120
     AWGKMLE                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page