(data stored in ACNUC30630 zone)

EMBL: AE000513.PE134

AE000513.PE134       Location/Qualifiers
FT   CDS             complement(135167..136204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0137"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09731"
FT                   /db_xref="InterPro:IPR025579"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY15"
FT                   /protein_id="AAF09731.1"
FT                   /translation="MPTESVQSAVQAIQGWLDDPPGEAVVRQCIVLRLLLAAGFDIWNP
FT                   DEVHPEETNVTGSRADFLVRRGAGVFALELKGMGATLQARDYQQALNYAVSVGTRWAIV
FT                   TNGRVWVVLDERRGGDWEARVALKTEMGQEGHTFGEDLATLLDPQIWEKDRFEAALKTV
FT                   AQRQERRRDEERIRREKRPLVEAEQARYKHKISFEEAADIASRVGLITEAERDVLLAPT
FT                   ESLPVPRADSDEIVFYFNSGPAQATATYHRITGLWILKAGSTARREIAPYAKATAKRRE
FT                   QYLLDGTLKDDGTILTFEKDVSHKAPSSAASDISGGSEPGWDVWKDAQGRSAQFYRPPR
FT                   ETSAE"
     MPTESVQSAV QAIQGWLDDP PGEAVVRQCI VLRLLLAAGF DIWNPDEVHP EETNVTGSRA        60
     DFLVRRGAGV FALELKGMGA TLQARDYQQA LNYAVSVGTR WAIVTNGRVW VVLDERRGGD       120
     WEARVALKTE MGQEGHTFGE DLATLLDPQI WEKDRFEAAL KTVAQRQERR RDEERIRREK       180
     RPLVEAEQAR YKHKISFEEA ADIASRVGLI TEAERDVLLA PTESLPVPRA DSDEIVFYFN       240
     SGPAQATATY HRITGLWILK AGSTARREIA PYAKATAKRR EQYLLDGTLK DDGTILTFEK       300
     DVSHKAPSSA ASDISGGSEP GWDVWKDAQG RSAQFYRPPR ETSAE                       345
//

If you have problems or comments...

PBIL Back to PBIL home page