(data stored in ACNUC30630 zone)

EMBL: AE000513.PE136

AE000513.PE136       Location/Qualifiers
FT   CDS             137279..138856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0139"
FT                   /product="GTP-binding protein HflX"
FT                   /note="similar to PID:1653117 percent identity: 60.78;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09728"
FT                   /db_xref="GOA:Q9RY13"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY13"
FT                   /protein_id="AAF09728.1"
FT                   /translation="MRREVGVLIDRRGRVISVSVADARGTEFPDLRLGENRLAGFHLLH
FT                   AHPRGGALSKGDLSTLFLKRLDAVSAIEVGNDGRPGLVHTAHLTPPGTVGEEEDWRILP
FT                   PAQPFEIDEFDLGAQVSALEEEIARAARTREAKKDHERALLVQIDGGEFDAEERLEELG
FT                   ELARTAGAEVVYKELIYRRNLKPGTLVGAGKLEELTSKAYHLDADLLIFGQELGPAQAR
FT                   EIEAATGLKVVDRTQLILDIFALHAQGVESRLQVELAQLRYMKPRLLGAGAQLSRIGGG
FT                   GGSAGGGAIGTRGPGETKLELDRRRINDRLSFLEKQLEGVSQRREERRKSRERNDVPVV
FT                   SIVGYTNAGKSTLLNSFTHAAEEPRRVLAENKLFATLRPTSRQGYIEGIGQVIFTDTVG
FT                   FIRDLPKDLSRAFRSTLEEIGDADVLLHVVDAASPGAEQRLDAVNRILDDLGFRDMPTV
FT                   VALNKADRAEPEVLAREQERTGGIPVSALKNIGLTELKEALGDAVASVQRAELARQEEA
FT                   RAARVEWR"
     MRREVGVLID RRGRVISVSV ADARGTEFPD LRLGENRLAG FHLLHAHPRG GALSKGDLST        60
     LFLKRLDAVS AIEVGNDGRP GLVHTAHLTP PGTVGEEEDW RILPPAQPFE IDEFDLGAQV       120
     SALEEEIARA ARTREAKKDH ERALLVQIDG GEFDAEERLE ELGELARTAG AEVVYKELIY       180
     RRNLKPGTLV GAGKLEELTS KAYHLDADLL IFGQELGPAQ AREIEAATGL KVVDRTQLIL       240
     DIFALHAQGV ESRLQVELAQ LRYMKPRLLG AGAQLSRIGG GGGSAGGGAI GTRGPGETKL       300
     ELDRRRINDR LSFLEKQLEG VSQRREERRK SRERNDVPVV SIVGYTNAGK STLLNSFTHA       360
     AEEPRRVLAE NKLFATLRPT SRQGYIEGIG QVIFTDTVGF IRDLPKDLSR AFRSTLEEIG       420
     DADVLLHVVD AASPGAEQRL DAVNRILDDL GFRDMPTVVA LNKADRAEPE VLAREQERTG       480
     GIPVSALKNI GLTELKEALG DAVASVQRAE LARQEEARAA RVEWR                       525
//

If you have problems or comments...

PBIL Back to PBIL home page