(data stored in ACNUC30630 zone)

EMBL: AE000513.PE138

AE000513.PE138       Location/Qualifiers
FT   CDS             141046..142839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0143"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09732"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY11"
FT                   /protein_id="AAF09732.1"
FT                   /translation="MIYRDIVDSLPAAPGGGQMVVSTSPNYQAVCVNSSGGIISNNSGY
FT                   NSLSYESSDGSGATVPPAPTAGATQWSVPGNTIIPAGTCRFSFDVTLPRAGTYKNVIPA
FT                   NIRTSGGNDADGAQASITAFAGPTVTKAYSPKSILGDGKATSTLTITLNNSSPAAVSLT
FT                   APLTDNIGNGLEITGVTTSCPGTATFSGTTITYPSGATLNPGTCTITATVRSATAGSYP
FT                   NTISAGALQTTVGNNAAAASDTLTVTSFTRLTITKTHASQNFTAGQTGTYTVTVSNASG
FT                   AAATSGALSLSDLLPSGMSFNSVTTTAGGSFGTRPASGATGRVDWTFTPSTPLAAGQSL
FT                   TFTVTVNVANTVANGATLTNYASVGGGGDPDVLPTPGATCTGEQCASDPTTVNRITQLT
FT                   LRKEFPQGAAGPKGFGNYDYATITISQGSSTLTTATTSSIANPGPVATDTINITPGANY
FT                   TLREVLKNDAVFSGPDSYDSRYTCTNATTGSTTVMPTNSSGMSFTLTPQAGDIITCSVG
FT                   DNFTFSRSWRAKSLDEHLQDRHELLGFPPEGIHEMLSTVPHQTDRSPTMLQNGDGPGLA
FT                   QPDPQAQTEHPSQCHQSEESL"
     MIYRDIVDSL PAAPGGGQMV VSTSPNYQAV CVNSSGGIIS NNSGYNSLSY ESSDGSGATV        60
     PPAPTAGATQ WSVPGNTIIP AGTCRFSFDV TLPRAGTYKN VIPANIRTSG GNDADGAQAS       120
     ITAFAGPTVT KAYSPKSILG DGKATSTLTI TLNNSSPAAV SLTAPLTDNI GNGLEITGVT       180
     TSCPGTATFS GTTITYPSGA TLNPGTCTIT ATVRSATAGS YPNTISAGAL QTTVGNNAAA       240
     ASDTLTVTSF TRLTITKTHA SQNFTAGQTG TYTVTVSNAS GAAATSGALS LSDLLPSGMS       300
     FNSVTTTAGG SFGTRPASGA TGRVDWTFTP STPLAAGQSL TFTVTVNVAN TVANGATLTN       360
     YASVGGGGDP DVLPTPGATC TGEQCASDPT TVNRITQLTL RKEFPQGAAG PKGFGNYDYA       420
     TITISQGSST LTTATTSSIA NPGPVATDTI NITPGANYTL REVLKNDAVF SGPDSYDSRY       480
     TCTNATTGST TVMPTNSSGM SFTLTPQAGD IITCSVGDNF TFSRSWRAKS LDEHLQDRHE       540
     LLGFPPEGIH EMLSTVPHQT DRSPTMLQNG DGPGLAQPDP QAQTEHPSQC HQSEESL          597
//

If you have problems or comments...

PBIL Back to PBIL home page