(data stored in ACNUC30630 zone)

EMBL: AE000513.PE142

AE000513.PE142       Location/Qualifiers
FT   CDS             complement(146367..146879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0147"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09741"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY07"
FT                   /protein_id="AAF09741.1"
FT                   /translation="MRHREHVLFDRNNVRAVAPIPLFLYSRPWVRELPYTSMVLASFSS
FT                   ELYLKGILLMHGIQPKHTHNPKDLFSRLPDSAQTEIAKHNHTTFSIDEILETSVGNFQK
FT                   IRYMRLTPVGFVSFSTLLVEILHRYVTDNFEDHGQRYAWEDFILPTDNNGSCSFVVVTE
FT                   GDQDLAV"
     MRHREHVLFD RNNVRAVAPI PLFLYSRPWV RELPYTSMVL ASFSSELYLK GILLMHGIQP        60
     KHTHNPKDLF SRLPDSAQTE IAKHNHTTFS IDEILETSVG NFQKIRYMRL TPVGFVSFST       120
     LLVEILHRYV TDNFEDHGQR YAWEDFILPT DNNGSCSFVV VTEGDQDLAV                  170
//

If you have problems or comments...

PBIL Back to PBIL home page