(data stored in ACNUC30630 zone)

EMBL: AE000513.PE147

AE000513.PE147       Location/Qualifiers
FT   CDS             complement(152616..153449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL123456 percent identity: 41.95;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09738"
FT                   /db_xref="GOA:Q9RY02"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY02"
FT                   /protein_id="AAF09738.1"
FT                   /translation="MAKQDTQLLGSANPTELKTPFFQVPTHHRAFSLGVMALPTRYTDA
FT                   GCVMATFEVDWDAANALIEAPDLDLVRLPNSKALMNVVVYEYRRLTNGTPYNEAGIALL
FT                   VNPQGYPLPADPQAALDLPADRRQLGDYIVDLPVTTAPACKAGIDLWGYPKFVTNIDFA
FT                   LQGKSFAGTVHDPEREDEFILKLEGEAGAEKRLDDWQDLVLYSKFEDQLFRATSVTRSD
FT                   EGRSAEPGTFVLTVSPTSLHPMATRLRQLIGDTATPTAVSYTPHFQLRLNEGVGI"
     MAKQDTQLLG SANPTELKTP FFQVPTHHRA FSLGVMALPT RYTDAGCVMA TFEVDWDAAN        60
     ALIEAPDLDL VRLPNSKALM NVVVYEYRRL TNGTPYNEAG IALLVNPQGY PLPADPQAAL       120
     DLPADRRQLG DYIVDLPVTT APACKAGIDL WGYPKFVTNI DFALQGKSFA GTVHDPERED       180
     EFILKLEGEA GAEKRLDDWQ DLVLYSKFED QLFRATSVTR SDEGRSAEPG TFVLTVSPTS       240
     LHPMATRLRQ LIGDTATPTA VSYTPHFQLR LNEGVGI                                277
//

If you have problems or comments...

PBIL Back to PBIL home page