(data stored in ACNUC30630 zone)

EMBL: AE000513.PE149

AE000513.PE149       Location/Qualifiers
FT   CDS             154966..155610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0154"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /note="similar to GB:L11391 PID:496180 SP:P51961 percent
FT                   identity: 66.50; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09743"
FT                   /db_xref="GOA:Q9RY00"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY00"
FT                   /protein_id="AAF09743.1"
FT                   /translation="MFTGIIEQIGRVTHAAEQNGNLAVTIAPTQMWADLVLGESIACGG
FT                   TCLTVTGWDEQSFCVDLSRETLAKTAPHWEAGQEVNLERAMTAQARFGGHIVSGHVDGV
FT                   GEVLEVREEPGAYTMRVRAPRSLAKYLTPKGSVTVDGVSLTLVDVGGPAGSRPEWPLDE
FT                   FTLWLVPHTLEVTTLKHWRAGTRVNLEADQVAKYVERLLAVGAASPAEVQQ"
     MFTGIIEQIG RVTHAAEQNG NLAVTIAPTQ MWADLVLGES IACGGTCLTV TGWDEQSFCV        60
     DLSRETLAKT APHWEAGQEV NLERAMTAQA RFGGHIVSGH VDGVGEVLEV REEPGAYTMR       120
     VRAPRSLAKY LTPKGSVTVD GVSLTLVDVG GPAGSRPEWP LDEFTLWLVP HTLEVTTLKH       180
     WRAGTRVNLE ADQVAKYVER LLAVGAASPA EVQQ                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page