(data stored in ACNUC30630 zone)

EMBL: AE000513.PE150

AE000513.PE150       Location/Qualifiers
FT   CDS             155607..156821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0155"
FT                   /product="GTP cyclohydrolase
FT                   II/3,4-dihydroxy-2-butanone-4-phosphate synthase"
FT                   /note="similar to GB:AE000657 percent identity: 75.56;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09744"
FT                   /db_xref="GOA:Q9RXZ9"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXZ9"
FT                   /protein_id="AAF09744.1"
FT                   /translation="MSDSITLSTIPDLLAELRAGRPVILVDDENRENEGDLLMPAATAT
FT                   PQWVNFMAREGRGLICVTLTPERARRLDLTPMVGAGAYGQGTDPNGTAFTVSVDHSSNS
FT                   TGISAYDRAATIAALLEDTSQPTDFRRPGHIFPLVARPGGVLRRAGHTEAGCDLARLAG
FT                   FAPVGVICEIMGDDGEMSRLPDLLAFGEKHGLKVGSIEALIAYRMEHDPFMEPVAEAEL
FT                   PTRFGDFRLIGFQDTLSGAEHVALVMGEVTPEPLLVRVHSECLTGDAFHSLRCDCGPQL
FT                   DAALQAIAEEGRGAVIYLRQEGRGIGLLNKIRAYALQDGGADTVDANLQLGLPADARDF
FT                   GIGAQILHLLGARKLRIMTNNPRKLHSLSGFGLEVVERVPLHVGEDPHNAGYLRTKREK
FT                   LGHLR"
     MSDSITLSTI PDLLAELRAG RPVILVDDEN RENEGDLLMP AATATPQWVN FMAREGRGLI        60
     CVTLTPERAR RLDLTPMVGA GAYGQGTDPN GTAFTVSVDH SSNSTGISAY DRAATIAALL       120
     EDTSQPTDFR RPGHIFPLVA RPGGVLRRAG HTEAGCDLAR LAGFAPVGVI CEIMGDDGEM       180
     SRLPDLLAFG EKHGLKVGSI EALIAYRMEH DPFMEPVAEA ELPTRFGDFR LIGFQDTLSG       240
     AEHVALVMGE VTPEPLLVRV HSECLTGDAF HSLRCDCGPQ LDAALQAIAE EGRGAVIYLR       300
     QEGRGIGLLN KIRAYALQDG GADTVDANLQ LGLPADARDF GIGAQILHLL GARKLRIMTN       360
     NPRKLHSLSG FGLEVVERVP LHVGEDPHNA GYLRTKREKL GHLR                        404
//

If you have problems or comments...

PBIL Back to PBIL home page