(data stored in ACNUC30630 zone)

EMBL: AE000513.PE154

AE000513.PE154       Location/Qualifiers
FT   CDS             160201..160833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0159"
FT                   /product="uridine kinase"
FT                   /note="similar to GB:AL009126 percent identity: 70.73;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09747"
FT                   /db_xref="GOA:Q9RXZ5"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXZ5"
FT                   /protein_id="AAF09747.1"
FT                   /translation="MSGPGTPFVIGVAGGSGSGKTTVTRRVIETVGREGVAVLNQDNYY
FT                   RDQSDIPFESRLHTNYDHPAAFDWALLREQLDALLAGVPIEMPEYDFTQHTRAAHTTRV
FT                   LPGRVVVLEGFFALYDEELRSRMGLKVFVDADADVRFIRRLLRDTQERGRTPESVIEQY
FT                   LGFVRPMHLSFVEPTKRYADVIIPHGGMNEPALDMLAARIRVMAQRD"
     MSGPGTPFVI GVAGGSGSGK TTVTRRVIET VGREGVAVLN QDNYYRDQSD IPFESRLHTN        60
     YDHPAAFDWA LLREQLDALL AGVPIEMPEY DFTQHTRAAH TTRVLPGRVV VLEGFFALYD       120
     EELRSRMGLK VFVDADADVR FIRRLLRDTQ ERGRTPESVI EQYLGFVRPM HLSFVEPTKR       180
     YADVIIPHGG MNEPALDMLA ARIRVMAQRD                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page