(data stored in ACNUC30630 zone)

EMBL: AE000513.PE155

AE000513.PE155       Location/Qualifiers
FT   CDS             160878..162800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0160"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09751"
FT                   /db_xref="GOA:Q9RXZ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXZ4"
FT                   /protein_id="AAF09751.1"
FT                   /translation="MMWISFNRLRISGVTDPLRSPAPVVPTGPARPSLVPPPNWHPRTP
FT                   LLLGLVFLSLIPALILTFQRVQFEQSRKVTALVMDYPALVIQARRYGQDPQALLNRYKA
FT                   LGVNGVALYEDTVASLQQRGEILLKNGYDLADKFPGAPVKPNAVYMRSVVPGVAESLPA
FT                   RYTIPTHTVTVGGQSWLEWPSDPSYLPAGPNRAQVAEFQRQGMVLVYRPYNDEARPVSQ
FT                   VGTDWPAVPYVAFTDDAVIGARTPELLEQVDRAMGQRIPAVIEGNIQDGLEDLVLTHGG
FT                   VRLFALAPSWQNQLTPEEIASKYNLAARERSQQLLYLRPFPTINETTDMLARLQELMKN
FT                   SGIKVGMPVTTAFEPSPVLRWLSIIGPLAALLLAGLSLPLRRLGLLGAAGTLLLCLGLN
FT                   YATPLAGFALVAAVTFPALGLLLRRSRITDWFIATGLSLVGVVFVSALGATPDSMLGLH
FT                   PFRGVGLTLLLPLAMVAASFLPKQDIRKTVSDVYNAPIKLGDIAVMGLGLALLGLVYSR
FT                   RGNATGGSVTEFESSLRQNVQDSMVRPRFKEVAAHPLAILGLSGKLPGYFSGLMLLGGT
FT                   MGQASILNTFSHFHTPFLISATRCFLGLGLGLLIGLLLVKLFDVLAGFWRSYRPDAAVG
FT                   PRARA"
     MMWISFNRLR ISGVTDPLRS PAPVVPTGPA RPSLVPPPNW HPRTPLLLGL VFLSLIPALI        60
     LTFQRVQFEQ SRKVTALVMD YPALVIQARR YGQDPQALLN RYKALGVNGV ALYEDTVASL       120
     QQRGEILLKN GYDLADKFPG APVKPNAVYM RSVVPGVAES LPARYTIPTH TVTVGGQSWL       180
     EWPSDPSYLP AGPNRAQVAE FQRQGMVLVY RPYNDEARPV SQVGTDWPAV PYVAFTDDAV       240
     IGARTPELLE QVDRAMGQRI PAVIEGNIQD GLEDLVLTHG GVRLFALAPS WQNQLTPEEI       300
     ASKYNLAARE RSQQLLYLRP FPTINETTDM LARLQELMKN SGIKVGMPVT TAFEPSPVLR       360
     WLSIIGPLAA LLLAGLSLPL RRLGLLGAAG TLLLCLGLNY ATPLAGFALV AAVTFPALGL       420
     LLRRSRITDW FIATGLSLVG VVFVSALGAT PDSMLGLHPF RGVGLTLLLP LAMVAASFLP       480
     KQDIRKTVSD VYNAPIKLGD IAVMGLGLAL LGLVYSRRGN ATGGSVTEFE SSLRQNVQDS       540
     MVRPRFKEVA AHPLAILGLS GKLPGYFSGL MLLGGTMGQA SILNTFSHFH TPFLISATRC       600
     FLGLGLGLLI GLLLVKLFDV LAGFWRSYRP DAAVGPRARA                             640
//

If you have problems or comments...

PBIL Back to PBIL home page