(data stored in ACNUC30630 zone)

EMBL: AE000513.PE156

AE000513.PE156       Location/Qualifiers
FT   CDS             162811..163788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1652052 percent identity: 50.67;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09748"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="InterPro:IPR019896"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXZ3"
FT                   /protein_id="AAF09748.1"
FT                   /translation="MKAVVSGYYGFGNTGDEAIALAITRELKKQGIDPVLLSNDPAESA
FT                   RLYGCEAVARMQPLDVGRALLRADLLLSGGGGLLQDKTSSRTLTYYLGVIRMARLLRKP
FT                   VFVFNQSVGPLSEAGRRQVQRGLRGVQAVVRDRGSQELLGQLGVPARLGGDPALLLRPS
FT                   AGLERDMSTVVIAPRGDVTETLAPLREVTALLRSRGRRVIALSFMPEQDDEAARSLGAA
FT                   EVLSTRDPQLALDTIARSGFVIGVRLHALILAAAAEVPFAGVAYDPKVQGFCDDAGAPV
FT                   FPVPPDAADLTAHAYERATPDWSAVEDMKFRAMESFAWLRQRGN"
     MKAVVSGYYG FGNTGDEAIA LAITRELKKQ GIDPVLLSND PAESARLYGC EAVARMQPLD        60
     VGRALLRADL LLSGGGGLLQ DKTSSRTLTY YLGVIRMARL LRKPVFVFNQ SVGPLSEAGR       120
     RQVQRGLRGV QAVVRDRGSQ ELLGQLGVPA RLGGDPALLL RPSAGLERDM STVVIAPRGD       180
     VTETLAPLRE VTALLRSRGR RVIALSFMPE QDDEAARSLG AAEVLSTRDP QLALDTIARS       240
     GFVIGVRLHA LILAAAAEVP FAGVAYDPKV QGFCDDAGAP VFPVPPDAAD LTAHAYERAT       300
     PDWSAVEDMK FRAMESFAWL RQRGN                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page