(data stored in ACNUC30630 zone)

EMBL: AE000513.PE158

AE000513.PE158       Location/Qualifiers
FT   CDS             164359..166179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0163"
FT                   /product="ABC transporter, ATP-binding protein, MsbA
FT                   family"
FT                   /note="similar to GB:AL009126 percent identity: 57.83;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09749"
FT                   /db_xref="GOA:Q9RXZ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXZ1"
FT                   /protein_id="AAF09749.1"
FT                   /translation="MSQPAQPSVTRRLYGLLTPYRTAVGAGLLLLLGSVAAELYPPLVW
FT                   IRVVDQGIPARDWGLIGGQLAVLVGVFALQQVLSAWRGVLLERAGQQFTLDLRTAVYRK
FT                   LQSQSADYFETQRTGDLLVRVTGDVDALQDVLVRGTDSVIANALRLVGVIGIFIALQPL
FT                   LGVLTTLPMLAVGLLLWNYGKTVRPAYRAARARLGELSALIADRLAGIRVVQGFAREEA
FT                   EAARVEALGRELYREQARAVALRNRAFPVARFVGNLGNVIMLGGGAWLILAGQFTLGGL
FT                   LAYRGYGRYFYGPIDDLVNISDLLQRAEAAGRRVFAVLDAPVTVADPAHPKPLPTPVRG
FT                   ELHFDNVTFGYDSASYDSASSDPTQPILRGVTLHIPAGQRVALLGASGAGKSTLLGLVT
FT                   RQHDPQSGRVLLDGVDVRDVALAELRTAAAVMPQDTFLFHDTVLENVRYARPDAALAEV
FT                   EEALRAAYALDFVRALPQGLETLVGERGVRLSGGQRQRLAIARTLLARPALLLLDEPTS
FT                   AVDAESEAQVVAALNDLMQGRTSLTVTHRLSLARAADRVLVLDGGVVVEDGPPALLRTR
FT                   GGPYARLEQVAERLERGEVAVISEVVNSSL"
     MSQPAQPSVT RRLYGLLTPY RTAVGAGLLL LLGSVAAELY PPLVWIRVVD QGIPARDWGL        60
     IGGQLAVLVG VFALQQVLSA WRGVLLERAG QQFTLDLRTA VYRKLQSQSA DYFETQRTGD       120
     LLVRVTGDVD ALQDVLVRGT DSVIANALRL VGVIGIFIAL QPLLGVLTTL PMLAVGLLLW       180
     NYGKTVRPAY RAARARLGEL SALIADRLAG IRVVQGFARE EAEAARVEAL GRELYREQAR       240
     AVALRNRAFP VARFVGNLGN VIMLGGGAWL ILAGQFTLGG LLAYRGYGRY FYGPIDDLVN       300
     ISDLLQRAEA AGRRVFAVLD APVTVADPAH PKPLPTPVRG ELHFDNVTFG YDSASYDSAS       360
     SDPTQPILRG VTLHIPAGQR VALLGASGAG KSTLLGLVTR QHDPQSGRVL LDGVDVRDVA       420
     LAELRTAAAV MPQDTFLFHD TVLENVRYAR PDAALAEVEE ALRAAYALDF VRALPQGLET       480
     LVGERGVRLS GGQRQRLAIA RTLLARPALL LLDEPTSAVD AESEAQVVAA LNDLMQGRTS       540
     LTVTHRLSLA RAADRVLVLD GGVVVEDGPP ALLRTRGGPY ARLEQVAERL ERGEVAVISE       600
     VVNSSL                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page