(data stored in ACNUC30630 zone)

EMBL: AE000513.PE162

AE000513.PE162       Location/Qualifiers
FT   CDS             169878..170864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0167"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09762"
FT                   /db_xref="GOA:Q9RXY7"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXY7"
FT                   /protein_id="AAF09762.1"
FT                   /translation="MPSANVSPPCPSGVRGGGMGPKAKAEASKPHPQIPVKLPFVTAPD
FT                   ALAAAKARMRDLAAAYVAALPGRDTHSLMAGVPGVDLKFMPLGWRDGAFDPEHNVILIN
FT                   SAARPERQRFTLAHEIGHAILLGDDDLLSDIHDAYEGERLEQVIETLCNVAAAAILMPE
FT                   PVIAEMLERFGPTGRALAELAKRAEVSASSALYALTEQTPVPVIYAVCAPGKPPREQAA
FT                   SDEDAGPSTEKVLTVRASSSTRGVKYTLASGTPVPADHPAALALATGMEVREESYVPFR
FT                   SGRKMKAEVDAYPSRGIVAVSFEFDPARLGRKDSEQADRDEPQDAAQ"
     MPSANVSPPC PSGVRGGGMG PKAKAEASKP HPQIPVKLPF VTAPDALAAA KARMRDLAAA        60
     YVAALPGRDT HSLMAGVPGV DLKFMPLGWR DGAFDPEHNV ILINSAARPE RQRFTLAHEI       120
     GHAILLGDDD LLSDIHDAYE GERLEQVIET LCNVAAAAIL MPEPVIAEML ERFGPTGRAL       180
     AELAKRAEVS ASSALYALTE QTPVPVIYAV CAPGKPPREQ AASDEDAGPS TEKVLTVRAS       240
     SSTRGVKYTL ASGTPVPADH PAALALATGM EVREESYVPF RSGRKMKAEV DAYPSRGIVA       300
     VSFEFDPARL GRKDSEQADR DEPQDAAQ                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page