(data stored in ACNUC30630 zone)

EMBL: AE000513.PE171

AE000513.PE171       Location/Qualifiers
FT   CDS             178048..178443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0177"
FT                   /product="transposase, putative"
FT                   /note="similar to GP:3426012 percent identity: 90.65;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09765"
FT                   /db_xref="GOA:Q9RXX8"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="PDB:2FYX"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXX8"
FT                   /protein_id="AAF09765.1"
FT                   /translation="MKKGRGYVYKLEYHLIWATKYRHQVLVDEVADGLKDILRDIATQN
FT                   GLELVALEVMPDYVHLLLGATPQHVIPDFVKALKGASARRMFSAFPHLKQPHWGGNLWN
FT                   PSYCVLTVSEHTRAQIQQYIENQHAAE"
     MKKGRGYVYK LEYHLIWATK YRHQVLVDEV ADGLKDILRD IATQNGLELV ALEVMPDYVH        60
     LLLGATPQHV IPDFVKALKG ASARRMFSAF PHLKQPHWGG NLWNPSYCVL TVSEHTRAQI       120
     QQYIENQHAA E                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page