(data stored in ACNUC30630 zone)

EMBL: AE000513.PE172

AE000513.PE172       Location/Qualifiers
FT   CDS             178430..179659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0178"
FT                   /product="transposase, putative"
FT                   /note="similar to GP:3426013 percent identity: 91.44;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09766"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXX7"
FT                   /protein_id="AAF09766.1"
FT                   /translation="MLRNKAFVVRLYPNAAQAERINRTLGCARFVYNHFLARRIESYRQ
FT                   DGKGMIYAATDKALTLLKREEGTAWLAEVDKFALQQSLRDLERAYQNFFRTAKKSGKKV
FT                   GFPKFKKKRTGEAYRTQFTNNNIEIGEGKLKLPKLGWVKTRGQRDMQGKILNVTVRRIH
FT                   EGHYEASVLCEVEIPYLPAAPKFAAGVDVGIKDFAIVTDGKGEFEHHANPKYYRSSLRR
FT                   LRKAQKTLSRRKKGSARYGRAKTTLARIHKRVANKRQDFIHKLTTSLVREYEITCTEHL
FT                   KPDNMRKNRRLALSVSDAGWGEFIRQLEYKATWYGRLVSKISPYFPSSQICHDCGFKNP
FT                   AVKNLAVREWTCPNCGETHDRDENAALNIRREGLVAAGMSDTQNAHGDCIRPTSVGSGL
FT                   RSENHATSVV"
     MLRNKAFVVR LYPNAAQAER INRTLGCARF VYNHFLARRI ESYRQDGKGM IYAATDKALT        60
     LLKREEGTAW LAEVDKFALQ QSLRDLERAY QNFFRTAKKS GKKVGFPKFK KKRTGEAYRT       120
     QFTNNNIEIG EGKLKLPKLG WVKTRGQRDM QGKILNVTVR RIHEGHYEAS VLCEVEIPYL       180
     PAAPKFAAGV DVGIKDFAIV TDGKGEFEHH ANPKYYRSSL RRLRKAQKTL SRRKKGSARY       240
     GRAKTTLARI HKRVANKRQD FIHKLTTSLV REYEITCTEH LKPDNMRKNR RLALSVSDAG       300
     WGEFIRQLEY KATWYGRLVS KISPYFPSSQ ICHDCGFKNP AVKNLAVREW TCPNCGETHD       360
     RDENAALNIR REGLVAAGMS DTQNAHGDCI RPTSVGSGLR SENHATSVV                   409
//

If you have problems or comments...

PBIL Back to PBIL home page