(data stored in ACNUC30630 zone)

EMBL: AE000513.PE176

AE000513.PE176       Location/Qualifiers
FT   CDS             complement(181526..182992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0182"
FT                   /product="glutamate synthase, small subunit"
FT                   /note="similar to GB:AL123456 percent identity: 72.27;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09769"
FT                   /db_xref="GOA:Q9RXX3"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXX3"
FT                   /protein_id="AAF09769.1"
FT                   /translation="MSKITGFLEQPRVKEQYAPIDARLKHYHEFMLPLDSASARLQATR
FT                   CMDCGIPFCNNGCPVNNIIPDFNNLVFEDDWKAALDVLHATNNFPEFTGRICPAPCEAA
FT                   CTLNISEDPVGIKSIELAIIERGWQEGWVRPTPAEVKTGKKVAVVGSGPAGLAAAQQLA
FT                   RAGHDVTVFEKNDRVGGLVRYGIPDFKLDKSHIDRRIEQMQAEGVTFRTGVLVGDWDEN
FT                   SKITNLSKERVTPAELREQFDAVVLAGGSETPRDLPAPGRELNGIHYAMEFLPQQNRVN
FT                   AGDKFKGQIRADGKHVVVIGGGDTGSDCVGTSNRHGAAGVTQFEVMPQPPEQENKPLTW
FT                   PYWPMKLRTSTSHEEGAVREFAIATKEFIGKGGKVTGVRTVRVEMKDGKLEEIPGSEET
FT                   HKADLVLLAMGFTNPMQSVLDAFGVDKDPRGNVLAGTEEHGGYLTSVPGVFAAGDMRRG
FT                   QSLVVWAIREGRQAARAVDQFLMGESVLPR"
     MSKITGFLEQ PRVKEQYAPI DARLKHYHEF MLPLDSASAR LQATRCMDCG IPFCNNGCPV        60
     NNIIPDFNNL VFEDDWKAAL DVLHATNNFP EFTGRICPAP CEAACTLNIS EDPVGIKSIE       120
     LAIIERGWQE GWVRPTPAEV KTGKKVAVVG SGPAGLAAAQ QLARAGHDVT VFEKNDRVGG       180
     LVRYGIPDFK LDKSHIDRRI EQMQAEGVTF RTGVLVGDWD ENSKITNLSK ERVTPAELRE       240
     QFDAVVLAGG SETPRDLPAP GRELNGIHYA MEFLPQQNRV NAGDKFKGQI RADGKHVVVI       300
     GGGDTGSDCV GTSNRHGAAG VTQFEVMPQP PEQENKPLTW PYWPMKLRTS TSHEEGAVRE       360
     FAIATKEFIG KGGKVTGVRT VRVEMKDGKL EEIPGSEETH KADLVLLAMG FTNPMQSVLD       420
     AFGVDKDPRG NVLAGTEEHG GYLTSVPGVF AAGDMRRGQS LVVWAIREGR QAARAVDQFL       480
     MGESVLPR                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page