(data stored in ACNUC30630 zone)

EMBL: AE000513.PE178

AE000513.PE178       Location/Qualifiers
FT   CDS             188132..188953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0184"
FT                   /product="enoyl-CoA hydratase, putative"
FT                   /note="similar to GB:AL123456 percent identity: 72.69;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09772"
FT                   /db_xref="GOA:Q9RXX1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXX1"
FT                   /protein_id="AAF09772.1"
FT                   /translation="MDTTQLTAPGAYPGLAVTLHDGGILEIVIRNEKTLNSVDRRGHAA
FT                   LTHIWRDIDAASGVRCVLIRGEGRGFSSGGDFELIEEMASDFTALARVWKEARDLVYNV
FT                   VNCGKPVVSAIHGPCVGAGLAVALLADVSVAAKSARILDGHVQLGVAAGDHAAIIWPLL
FT                   CGLNKAKYHLLTGESVSGEEAERIGLVSLCVPDEELLDRAWAVARKLAAGSPTAVRWTK
FT                   YALNNWLRAMGPTFDASLALEFLGFTGPDIHEGLAAKRERREPRFMEDAPI"
     MDTTQLTAPG AYPGLAVTLH DGGILEIVIR NEKTLNSVDR RGHAALTHIW RDIDAASGVR        60
     CVLIRGEGRG FSSGGDFELI EEMASDFTAL ARVWKEARDL VYNVVNCGKP VVSAIHGPCV       120
     GAGLAVALLA DVSVAAKSAR ILDGHVQLGV AAGDHAAIIW PLLCGLNKAK YHLLTGESVS       180
     GEEAERIGLV SLCVPDEELL DRAWAVARKL AAGSPTAVRW TKYALNNWLR AMGPTFDASL       240
     ALEFLGFTGP DIHEGLAAKR ERREPRFMED API                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page