(data stored in ACNUC30630 zone)

EMBL: AE000513.PE181

AE000513.PE181       Location/Qualifiers
FT   CDS             complement(191072..191740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0187"
FT                   /product="sanA protein"
FT                   /note="similar to SP:P33017 PID:405877 PID:1161522
FT                   GB:U00096 PID:1788466 percent identity: 67.89; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09774"
FT                   /db_xref="GOA:Q9RXW8"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXW8"
FT                   /protein_id="AAF09774.1"
FT                   /translation="MGSASLTPVKTRIRWRRWAAGGVGALLAGVLLPQIVVPLAAWGRT
FT                   FDRPEDLPARHVGLVLGTSKYLASGRVNRYYLYRIDAAEAAYKAGKVRVLLLSGDNSSV
FT                   SYDEPTTMKEDLLERGIPAEQLVLDYAGFRTLDSVVRAAEVFGTRQFTLISQPFHNERA
FT                   IFLARTRGLDAAALNARDVTGRSGLKVQGREVLARVKAVLDVLRGKGPKFLGEPVDVPE
FT                   "
     MGSASLTPVK TRIRWRRWAA GGVGALLAGV LLPQIVVPLA AWGRTFDRPE DLPARHVGLV        60
     LGTSKYLASG RVNRYYLYRI DAAEAAYKAG KVRVLLLSGD NSSVSYDEPT TMKEDLLERG       120
     IPAEQLVLDY AGFRTLDSVV RAAEVFGTRQ FTLISQPFHN ERAIFLARTR GLDAAALNAR       180
     DVTGRSGLKV QGREVLARVK AVLDVLRGKG PKFLGEPVDV PE                          222
//

If you have problems or comments...

PBIL Back to PBIL home page