(data stored in ACNUC30630 zone)

EMBL: AE000513.PE184

AE000513.PE184       Location/Qualifiers
FT   CDS             complement(192846..194054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000657 percent identity: 51.03;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09777"
FT                   /db_xref="GOA:Q9RXW5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXW5"
FT                   /protein_id="AAF09777.1"
FT                   /translation="MTTPTPTPTPTSQSLAAPFAQGVEGVYFDGRSSRDRAATLRVLGS
FT                   GDLSSGAPLAVLRVAPTDGEPGSEQQWPLRQVQFDPPLAGVRRVVKLPDGGRFETNDDR
FT                   AITALEAAVGRNRGLRGVRRLESDWGLTLGAVVTLGLFVWGFLTYGLPAMARSAAAATP
FT                   RSVLTSFDTSAIEVLDNGTFMGPTHLSAARQAQLQREFKDVAQWAGGGYPYRLLLRDGT
FT                   PQANGDKDSPAPSGSIGTNAFALPGGTVVMTEQLVKLAHSDRELMGVLAHETGHVTHRH
FT                   SLSSIYQGLGLTLLTTAVTGDLIGASTFAAAVPTWLLKNGYSRQSETQSDEVAGRFLME
FT                   RYGTTKPLRDVLARLETEDENADENSVKRDDPGAFLQTHPGTAERIRHLREIEQNWPQR
FT                   RGK"
     MTTPTPTPTP TSQSLAAPFA QGVEGVYFDG RSSRDRAATL RVLGSGDLSS GAPLAVLRVA        60
     PTDGEPGSEQ QWPLRQVQFD PPLAGVRRVV KLPDGGRFET NDDRAITALE AAVGRNRGLR       120
     GVRRLESDWG LTLGAVVTLG LFVWGFLTYG LPAMARSAAA ATPRSVLTSF DTSAIEVLDN       180
     GTFMGPTHLS AARQAQLQRE FKDVAQWAGG GYPYRLLLRD GTPQANGDKD SPAPSGSIGT       240
     NAFALPGGTV VMTEQLVKLA HSDRELMGVL AHETGHVTHR HSLSSIYQGL GLTLLTTAVT       300
     GDLIGASTFA AAVPTWLLKN GYSRQSETQS DEVAGRFLME RYGTTKPLRD VLARLETEDE       360
     NADENSVKRD DPGAFLQTHP GTAERIRHLR EIEQNWPQRR GK                          402
//

If you have problems or comments...

PBIL Back to PBIL home page