(data stored in ACNUC30630 zone)

EMBL: AE000513.PE186

AE000513.PE186       Location/Qualifiers
FT   CDS             196635..197312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0192"
FT                   /product="MutT/nudix family protein"
FT                   /note="similar to GP:3036882 percent identity: 57.60;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09779"
FT                   /db_xref="GOA:Q9RXW3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXW3"
FT                   /protein_id="AAF09779.1"
FT                   /translation="MSLLTLPPQATEVGLAVDVAAFAMHAGELRVLLVQRGELPHAQTW
FT                   ALPGGFVQPGEELHEAALRELRTETSVSLEPRHLEQFFTFGEVGRDPRGRVVSVAHLAV
FT                   LPHGTVEARAGGHTVGAEWLAAHTPPALAFDHQAILDRAIKRLQLRLDYANLALEFLPD
FT                   TFTLPELQGVYEAIGHRELDKRNFRKRILAAGILTPCGERRSGVGRPAQLYRRAKGTRT
FT                   AAL"
     MSLLTLPPQA TEVGLAVDVA AFAMHAGELR VLLVQRGELP HAQTWALPGG FVQPGEELHE        60
     AALRELRTET SVSLEPRHLE QFFTFGEVGR DPRGRVVSVA HLAVLPHGTV EARAGGHTVG       120
     AEWLAAHTPP ALAFDHQAIL DRAIKRLQLR LDYANLALEF LPDTFTLPEL QGVYEAIGHR       180
     ELDKRNFRKR ILAAGILTPC GERRSGVGRP AQLYRRAKGT RTAAL                       225
//

If you have problems or comments...

PBIL Back to PBIL home page