(data stored in ACNUC30630 zone)

EMBL: AE000513.PE193

AE000513.PE193       Location/Qualifiers
FT   CDS             complement(202908..203198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:D26185 SP:P24281 GB:X17014 PID:40073
FT                   PID:467410 percent identity: 70.10; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09786"
FT                   /db_xref="GOA:Q9RXV7"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXV7"
FT                   /protein_id="AAF09786.1"
FT                   /translation="MDMKKLMKQMQQAQVAAGKIQDELAAQSVEGTASGLVTVQMNGHG
FT                   KVTSLKIKPEAVDGDDVEALEDLILAAINDAAEKAEGLQREATAGLGLPGF"
     MDMKKLMKQM QQAQVAAGKI QDELAAQSVE GTASGLVTVQ MNGHGKVTSL KIKPEAVDGD        60
     DVEALEDLIL AAINDAAEKA EGLQREATAG LGLPGF                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page