(data stored in ACNUC30630 zone)

EMBL: AE000513.PE194

AE000513.PE194       Location/Qualifiers
FT   CDS             203333..203845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0200"
FT                   /product="transcriptional regulator, Lrp/AsnC family"
FT                   /note="similar to PID:1816639 percent identity: 55.28;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09787"
FT                   /db_xref="GOA:Q9RXV6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXV6"
FT                   /protein_id="AAF09787.1"
FT                   /translation="MPFAHFDLSNVRLRTMKSPAYRLDALDERILQELQQDSRLSMREL
FT                   GRRIGLSAPAVTERVRRLEEAGVVLGYGVRVAAKPLGRAISAFIGVKDSGRNDPALVRW
FT                   ARERDGVLECHSVTGDNSCMLKVAVADVAELEVLLGELIDLGFTCDTSIVLSTPLEGKL
FT                   LLPPQED"
     MPFAHFDLSN VRLRTMKSPA YRLDALDERI LQELQQDSRL SMRELGRRIG LSAPAVTERV        60
     RRLEEAGVVL GYGVRVAAKP LGRAISAFIG VKDSGRNDPA LVRWARERDG VLECHSVTGD       120
     NSCMLKVAVA DVAELEVLLG ELIDLGFTCD TSIVLSTPLE GKLLLPPQED                  170
//

If you have problems or comments...

PBIL Back to PBIL home page