(data stored in ACNUC30630 zone)

EMBL: AE000513.PE198

AE000513.PE198       Location/Qualifiers
FT   CDS             206335..207168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1653967 percent identity: 49.48;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09789"
FT                   /db_xref="GOA:Q9RXV2"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXV2"
FT                   /protein_id="AAF09789.1"
FT                   /translation="MRDPHHPSPLYHLRLYFLLLRAQARSQQVYRLSFALDALAAALIT
FT                   FTEFMAFVLVLPRFGGLGGWTLPEVSLLYGLAELSFVVMDMLFGGFDAPNMSQQVRSGS
FT                   FSTFLLRPLPLPLQVFGSDFALRRVTRVLLAVGIVAYAVSGLDISWTPADIALLVGSVL
FT                   GMTAFFGGLFVIGGTLTFWTVESVEAMNVLTYGGRSLISYPMDIYGTFLRKTFTYVIPA
FT                   AFLSYFPVLHVLGRPLPDGLPEWAAFLPLPAGVLVLTLAFAFWRVGVRRYVGTGS"
     MRDPHHPSPL YHLRLYFLLL RAQARSQQVY RLSFALDALA AALITFTEFM AFVLVLPRFG        60
     GLGGWTLPEV SLLYGLAELS FVVMDMLFGG FDAPNMSQQV RSGSFSTFLL RPLPLPLQVF       120
     GSDFALRRVT RVLLAVGIVA YAVSGLDISW TPADIALLVG SVLGMTAFFG GLFVIGGTLT       180
     FWTVESVEAM NVLTYGGRSL ISYPMDIYGT FLRKTFTYVI PAAFLSYFPV LHVLGRPLPD       240
     GLPEWAAFLP LPAGVLVLTL AFAFWRVGVR RYVGTGS                                277
//

If you have problems or comments...

PBIL Back to PBIL home page