(data stored in ACNUC30630 zone)

EMBL: AE000513.PE199

AE000513.PE199       Location/Qualifiers
FT   CDS             207113..208177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0205"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="similar to PID:1652437 percent identity: 61.95;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09790"
FT                   /db_xref="GOA:Q9RXV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXV1"
FT                   /protein_id="AAF09790.1"
FT                   /translation="MPSPSGGWGCGGTWARGVDGARLFSIHHQAVRPNLSTISPPKEPP
FT                   MIEVRHLCKSFARKPAVQDISFSIPAGEIVGYLGPNGAGKSTTIKVLTGLLVPDSGEVR
FT                   VGGLVPWKQRRQHVARLGAVFGQRTTLWWDLPVRESLELLRHVYRVPAARFAENLAGFT
FT                   ELLELGPFLNTPARALSLGQRMRADLAAALLHDPELLFLDEPTVGLDVVAKERIREFVK
FT                   AVNAERGVTVLLTTHDLGDVERLARRVMMIDTGRLLFDGPLAELQARYGGERELWVEFE
FT                   KAPAQPALPGLTLLGQDGPRVRYGFSGAAAAPIAQVTALAPVRDLAVKEPEVEATIRRI
FT                   YEGNLLGSRSVREG"
     MPSPSGGWGC GGTWARGVDG ARLFSIHHQA VRPNLSTISP PKEPPMIEVR HLCKSFARKP        60
     AVQDISFSIP AGEIVGYLGP NGAGKSTTIK VLTGLLVPDS GEVRVGGLVP WKQRRQHVAR       120
     LGAVFGQRTT LWWDLPVRES LELLRHVYRV PAARFAENLA GFTELLELGP FLNTPARALS       180
     LGQRMRADLA AALLHDPELL FLDEPTVGLD VVAKERIREF VKAVNAERGV TVLLTTHDLG       240
     DVERLARRVM MIDTGRLLFD GPLAELQARY GGERELWVEF EKAPAQPALP GLTLLGQDGP       300
     RVRYGFSGAA AAPIAQVTAL APVRDLAVKE PEVEATIRRI YEGNLLGSRS VREG             354
//

If you have problems or comments...

PBIL Back to PBIL home page