(data stored in ACNUC30630 zone)

EMBL: AE000513.PE23

AE000513.PE23        Location/Qualifiers
FT   CDS             22763..23875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0024"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /note="similar to SP:P72158 PID:1621601 percent identity:
FT                   59.05; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09616"
FT                   /db_xref="GOA:Q9RYC6"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYC6"
FT                   /protein_id="AAF09616.1"
FT                   /translation="MSDQPAATLGILGGGQLAQMLALAALPLGVQVRVLEPDAEAPARL
FT                   CAEHVHAPYTDPAGLDALAACDAVTLEFENVPVESLDALRGRVPVRPGAGLLARSKHRA
FT                   REKAALQEAGARTAPFVVIQREADLDGALDRVGGQGILKTSELGYDGKGQVRVASDTDL
FT                   RQGWAELGQVACILEGFVTFEREVSLAVARTADGRLAFGPLVENVHRDGILRTSVYPAA
FT                   VPDGTEARAREMARAVAEGWGLEGLLTLEFFQVPDGDLLVNEVAPRVHNSGHLTQDGGG
FT                   ASQFEAQVRAVLGLPLSDWSPLLPCAMVNYVGVEGAAPDWAAIDALPGTRVHLYHKAHR
FT                   TGRKLGHVNLAAPDLPTLHQRLAQLEQLIP"
     MSDQPAATLG ILGGGQLAQM LALAALPLGV QVRVLEPDAE APARLCAEHV HAPYTDPAGL        60
     DALAACDAVT LEFENVPVES LDALRGRVPV RPGAGLLARS KHRAREKAAL QEAGARTAPF       120
     VVIQREADLD GALDRVGGQG ILKTSELGYD GKGQVRVASD TDLRQGWAEL GQVACILEGF       180
     VTFEREVSLA VARTADGRLA FGPLVENVHR DGILRTSVYP AAVPDGTEAR AREMARAVAE       240
     GWGLEGLLTL EFFQVPDGDL LVNEVAPRVH NSGHLTQDGG GASQFEAQVR AVLGLPLSDW       300
     SPLLPCAMVN YVGVEGAAPD WAAIDALPGT RVHLYHKAHR TGRKLGHVNL AAPDLPTLHQ       360
     RLAQLEQLIP                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page