(data stored in ACNUC30630 zone)

EMBL: AE000513.PE251

AE000513.PE251       Location/Qualifiers
FT   CDS             complement(261733..262881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0260"
FT                   /product="CynX-related transport protein, putative"
FT                   /note="similar to GB:D26185 SP:P37482 PID:467333
FT                   GB:AL009126 percent identity: 59.89; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09845"
FT                   /db_xref="GOA:Q9RXP9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXP9"
FT                   /protein_id="AAF09845.1"
FT                   /translation="MNRAPRPLLVLGIVLVALTLRPVIAGFGPLLPRVQAELHASAATM
FT                   SLLTTIPLVCWGIFALVTPRLTRWRSPEVLIGLCTALIALGTWLRTGAALPPILLGTVL
FT                   VGVGIAIVNVLLPSLLRRDFPRQLGLMTGLYSLAVVGGAALASALAVPLERTLGGWRGS
FT                   LGVWAWLSGAALLAWVPAMLGRPARSAGPAVRGPSVWSNPATLPVTLYMGTQSLVFFTW
FT                   LTWLARLLQDRGLSAEAAGALLSLGNLVQLPFTLSVPVLASRLGNVRPLVFGLVACNAA
FT                   GLLGLTLWPTASPLPWVLLLGVGAGSAFPLALHLIAVRARDAAEVPRLSATAQGFGYLL
FT                   AASGPFLFGALHDLSGGWSASLSALLVGTAAMLVTGLWAAQR"
     MNRAPRPLLV LGIVLVALTL RPVIAGFGPL LPRVQAELHA SAATMSLLTT IPLVCWGIFA        60
     LVTPRLTRWR SPEVLIGLCT ALIALGTWLR TGAALPPILL GTVLVGVGIA IVNVLLPSLL       120
     RRDFPRQLGL MTGLYSLAVV GGAALASALA VPLERTLGGW RGSLGVWAWL SGAALLAWVP       180
     AMLGRPARSA GPAVRGPSVW SNPATLPVTL YMGTQSLVFF TWLTWLARLL QDRGLSAEAA       240
     GALLSLGNLV QLPFTLSVPV LASRLGNVRP LVFGLVACNA AGLLGLTLWP TASPLPWVLL       300
     LGVGAGSAFP LALHLIAVRA RDAAEVPRLS ATAQGFGYLL AASGPFLFGA LHDLSGGWSA       360
     SLSALLVGTA AMLVTGLWAA QR                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page