(data stored in ACNUC30630 zone)

EMBL: AE000513.PE263

AE000513.PE263       Location/Qualifiers
FT   CDS             276327..276908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0273"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09868"
FT                   /db_xref="GOA:Q9RXN7"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXN7"
FT                   /protein_id="AAF09868.1"
FT                   /translation="MRKAEVTTIHDLRSTFPRAGRLNWIGLREGRRLPVLSVPEAEAHP
FT                   LVGLLGDHGKTAPPRLTALSGEAGEVATPAHAPAIPGGPGRRQVTLIQAEHLPVIAALA
FT                   GLGSVAPELLRRNLLVSGIPLLALKDRRFQIGEVVLEGTGECHPCSRMEETLGPGGYNA
FT                   VRGHGGLTARVIRGGRLRVGDPVTVWEEER"
     MRKAEVTTIH DLRSTFPRAG RLNWIGLREG RRLPVLSVPE AEAHPLVGLL GDHGKTAPPR        60
     LTALSGEAGE VATPAHAPAI PGGPGRRQVT LIQAEHLPVI AALAGLGSVA PELLRRNLLV       120
     SGIPLLALKD RRFQIGEVVL EGTGECHPCS RMEETLGPGG YNAVRGHGGL TARVIRGGRL       180
     RVGDPVTVWE EER                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page