(data stored in ACNUC30630 zone)

EMBL: AE000513.PE273

AE000513.PE273       Location/Qualifiers
FT   CDS             284023..284895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0283"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="similar to GB:AE000782 percent identity: 70.33;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09865"
FT                   /db_xref="GOA:Q9RXM7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXM7"
FT                   /protein_id="AAF09865.1"
FT                   /translation="MTNPSTPPLSGAPLLEVQGLGIRFGGLHAVRDVTAQLQPGRITAI
FT                   IGPNGAGKSTFFNLISGFYKPTSGRIIFRGEDITPLRTHLVVGRGIARTFQTTTIYQEL
FT                   SVLDNAMIGHRVRTRAGLLDALLRTGRERHDESESRAGAMRALERVGLAGQAALPAGAL
FT                   NQEGKKRVGIAMALASDPHLLLLDEPAAGMNPEETENLMGLIRQLVSGGLSIALVEHKM
FT                   NLVMGLADDILVLHHGQKIAQGTPAQITRDPAVVEAYLGSHAHGGQMGQEQEQGGQPGT
FT                   VQDAGVDHA"
     MTNPSTPPLS GAPLLEVQGL GIRFGGLHAV RDVTAQLQPG RITAIIGPNG AGKSTFFNLI        60
     SGFYKPTSGR IIFRGEDITP LRTHLVVGRG IARTFQTTTI YQELSVLDNA MIGHRVRTRA       120
     GLLDALLRTG RERHDESESR AGAMRALERV GLAGQAALPA GALNQEGKKR VGIAMALASD       180
     PHLLLLDEPA AGMNPEETEN LMGLIRQLVS GGLSIALVEH KMNLVMGLAD DILVLHHGQK       240
     IAQGTPAQIT RDPAVVEAYL GSHAHGGQMG QEQEQGGQPG TVQDAGVDHA                  290
//

If you have problems or comments...

PBIL Back to PBIL home page