(data stored in ACNUC30630 zone)

EMBL: AE000513.PE280

AE000513.PE280       Location/Qualifiers
FT   CDS             292117..293337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:Pyro_h percent identity: 47.06;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09871"
FT                   /db_xref="GOA:Q9RXM0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXM0"
FT                   /protein_id="AAF09871.1"
FT                   /translation="MSWRFTRQVWLYLLSAFSFGLSQAFMMLFLNFYLRALGLDPAWQG
FT                   FLNALPALTLAALSLPAVALARRISNAHTLKVGAALSMLGTLLMALAHGPVLVIVGGLI
FT                   QGAGSALSVVAGAPFMANNSDEKSRVALFSVQSALMTGAGFLGNLLGGRVPELYAAATH
FT                   TLPSSLGALRVALLVAAGLQLLGLLPVLFLRPSGKTRPAGRSLAVRDKATMARLVFPNV
FT                   LVGLGAGATIPFLNVYIEGRFHVDYASLGSLFAWTSLATALTSLVQPLLVRRLGQLPTV
FT                   LAVQVSSLPFLALLGFAPQLWMVTVAMFTRGALMNAAGPVYSAYAMTVLPEEDRPMYSA
FT                   VNTMAWDLGWALSSMLSGVVRGALDFSLAFNVLFGWTLLMYAASVLAIYLGLYRRAGAG
FT                   VRAGGVH"
     MSWRFTRQVW LYLLSAFSFG LSQAFMMLFL NFYLRALGLD PAWQGFLNAL PALTLAALSL        60
     PAVALARRIS NAHTLKVGAA LSMLGTLLMA LAHGPVLVIV GGLIQGAGSA LSVVAGAPFM       120
     ANNSDEKSRV ALFSVQSALM TGAGFLGNLL GGRVPELYAA ATHTLPSSLG ALRVALLVAA       180
     GLQLLGLLPV LFLRPSGKTR PAGRSLAVRD KATMARLVFP NVLVGLGAGA TIPFLNVYIE       240
     GRFHVDYASL GSLFAWTSLA TALTSLVQPL LVRRLGQLPT VLAVQVSSLP FLALLGFAPQ       300
     LWMVTVAMFT RGALMNAAGP VYSAYAMTVL PEEDRPMYSA VNTMAWDLGW ALSSMLSGVV       360
     RGALDFSLAF NVLFGWTLLM YAASVLAIYL GLYRRAGAGV RAGGVH                      406
//

If you have problems or comments...

PBIL Back to PBIL home page