(data stored in ACNUC30630 zone)

EMBL: AE000513.PE285

AE000513.PE285       Location/Qualifiers
FT   CDS             complement(296920..297768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0295"
FT                   /product="phosphoprotein phosphatase"
FT                   /note="similar to GB:U00096 SP:P55798 PID:1736483
FT                   PID:1788143 PID:2039141 percent identity: 52.70; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09876"
FT                   /db_xref="GOA:Q9RXL5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXL5"
FT                   /protein_id="AAF09876.1"
FT                   /translation="MRQVIVIPDLHGRVDLLRAAVDRFPSAHFLSLGDAIDRGPNSLAT
FT                   IELLLELHAAGRATLLMGNHERMAQEGPRWYKDYLGTHDMGDYRRAMEGYHWWMRAGGE
FT                   TVRRELGSLTLEQFPALLERYLNLPDLRRVVYVTADGEIHAEAPGADRPSVLVSHAAPP
FT                   VAHQTHPNPLSAALWLRPFEGPFPLPDGVVYSLHGHTPVRQPTRLGRHVYVDLGAYETG
FT                   RLALVELGNPQERPVIRVLQGRGTPETARKYMQFGEPMPSEELRLSEPRPAPPQSNSSP
FT                   W"
     MRQVIVIPDL HGRVDLLRAA VDRFPSAHFL SLGDAIDRGP NSLATIELLL ELHAAGRATL        60
     LMGNHERMAQ EGPRWYKDYL GTHDMGDYRR AMEGYHWWMR AGGETVRREL GSLTLEQFPA       120
     LLERYLNLPD LRRVVYVTAD GEIHAEAPGA DRPSVLVSHA APPVAHQTHP NPLSAALWLR       180
     PFEGPFPLPD GVVYSLHGHT PVRQPTRLGR HVYVDLGAYE TGRLALVELG NPQERPVIRV       240
     LQGRGTPETA RKYMQFGEPM PSEELRLSEP RPAPPQSNSS PW                          282
//

If you have problems or comments...

PBIL Back to PBIL home page