(data stored in ACNUC30630 zone)

EMBL: AE000513.PE3

AE000513.PE3         Location/Qualifiers
FT   CDS             3412..4287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0003"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09602"
FT                   /db_xref="GOA:Q9RYE6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RYE6"
FT                   /protein_id="AAF09602.1"
FT                   /translation="MGTGDPSPLASQGPLPLVEGQKMKKPPPVRRGMNEAMEDRGSFFM
FT                   ALVSAYALHLARPFPALALAAGYLFVEGEDGCVAPRFAFLNGAGGHGVDVGQPQQFGAR
FT                   QAVAGGLDAAFLTYRRAVLAKDGAVADAAELTVDPALATVPGDGGEQFAPGASAFQSGS
FT                   EPAPGVRLGVALGNLGSHAHVALHGAGEQLPRPLLPAPGFGGVEGEGKRHEIGHAHGGL
FT                   GSGAEVAVRLGQAVFDQRRFPALGEPELLLGGGGVKQTVRADRQPHGAEIEGQRSVLHT
FT                   DILAQIMFLT"
     MGTGDPSPLA SQGPLPLVEG QKMKKPPPVR RGMNEAMEDR GSFFMALVSA YALHLARPFP        60
     ALALAAGYLF VEGEDGCVAP RFAFLNGAGG HGVDVGQPQQ FGARQAVAGG LDAAFLTYRR       120
     AVLAKDGAVA DAAELTVDPA LATVPGDGGE QFAPGASAFQ SGSEPAPGVR LGVALGNLGS       180
     HAHVALHGAG EQLPRPLLPA PGFGGVEGEG KRHEIGHAHG GLGSGAEVAV RLGQAVFDQR       240
     RFPALGEPEL LLGGGGVKQT VRADRQPHGA EIEGQRSVLH TDILAQIMFL T                291
//

If you have problems or comments...

PBIL Back to PBIL home page