(data stored in ACNUC30630 zone)

EMBL: AE000513.PE309

AE000513.PE309       Location/Qualifiers
FT   CDS             317410..317814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0321"
FT                   /product="ribosomal protein L14"
FT                   /note="similar to SP:P24317 PID:48104 PID:755806 percent
FT                   identity: 86.18; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09902"
FT                   /db_xref="GOA:Q9RXJ2"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="PDB:1GS2"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:2ZJP"
FT                   /db_xref="PDB:2ZJQ"
FT                   /db_xref="PDB:2ZJR"
FT                   /db_xref="PDB:3CF5"
FT                   /db_xref="PDB:3DLL"
FT                   /db_xref="PDB:3PIO"
FT                   /db_xref="PDB:3PIP"
FT                   /db_xref="PDB:4IO9"
FT                   /db_xref="PDB:4IOA"
FT                   /db_xref="PDB:4IOC"
FT                   /db_xref="PDB:4U67"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="PDB:4WFN"
FT                   /db_xref="PDB:5DM6"
FT                   /db_xref="PDB:5DM7"
FT                   /db_xref="PDB:5JVG"
FT                   /db_xref="PDB:5JVH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXJ2"
FT                   /protein_id="AAF09902.1"
FT                   /translation="MIMPQSRLDVADNSGAREIMCIRVLNSGIGGKGLTTGGGGNKRYA
FT                   HVGDIIVASVKDAAPRGAVKAGDVVKAVVVRTSHAIKRADGSTIRFDRNAAVIINNQGE
FT                   PRGTRVFGPVARELRDRRFMKIVSLAPEVL"
     MIMPQSRLDV ADNSGAREIM CIRVLNSGIG GKGLTTGGGG NKRYAHVGDI IVASVKDAAP        60
     RGAVKAGDVV KAVVVRTSHA IKRADGSTIR FDRNAAVIIN NQGEPRGTRV FGPVARELRD       120
     RRFMKIVSLA PEVL                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page