(data stored in ACNUC30630 zone)

EMBL: AE000513.PE310

AE000513.PE310       Location/Qualifiers
FT   CDS             317814..318161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0322"
FT                   /product="ribosomal protein L24"
FT                   /note="similar to SP:P04455 percent identity: 73.53;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09903"
FT                   /db_xref="GOA:Q9RXJ1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="PDB:1GS2"
FT                   /db_xref="PDB:1NKW"
FT                   /db_xref="PDB:1NWX"
FT                   /db_xref="PDB:1NWY"
FT                   /db_xref="PDB:1SM1"
FT                   /db_xref="PDB:1XBP"
FT                   /db_xref="PDB:2D3O"
FT                   /db_xref="PDB:2ZJP"
FT                   /db_xref="PDB:2ZJQ"
FT                   /db_xref="PDB:2ZJR"
FT                   /db_xref="PDB:3CF5"
FT                   /db_xref="PDB:3DLL"
FT                   /db_xref="PDB:3PIO"
FT                   /db_xref="PDB:3PIP"
FT                   /db_xref="PDB:4IO9"
FT                   /db_xref="PDB:4IOA"
FT                   /db_xref="PDB:4IOC"
FT                   /db_xref="PDB:4U67"
FT                   /db_xref="PDB:4V49"
FT                   /db_xref="PDB:4V4A"
FT                   /db_xref="PDB:4V4G"
FT                   /db_xref="PDB:4WFN"
FT                   /db_xref="PDB:5DM6"
FT                   /db_xref="PDB:5DM7"
FT                   /db_xref="PDB:5JVG"
FT                   /db_xref="PDB:5JVH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXJ1"
FT                   /protein_id="AAF09903.1"
FT                   /translation="MPRPSAGSHHNDKLHFKKGDTVIVLSGKHKGQTGKVLLALPRDQK
FT                   VVVEGVNVITKNVKPSMTNPQGGQEQRELALHASKVALVDPETGKATRVRKQIVDGKKV
FT                   RVAVASGKTID"
     MPRPSAGSHH NDKLHFKKGD TVIVLSGKHK GQTGKVLLAL PRDQKVVVEG VNVITKNVKP        60
     SMTNPQGGQE QRELALHASK VALVDPETGK ATRVRKQIVD GKKVRVAVAS GKTID            115
//

If you have problems or comments...

PBIL Back to PBIL home page