(data stored in ACNUC30630 zone)

EMBL: AE000513.PE321

AE000513.PE321       Location/Qualifiers
FT   CDS             328300..328959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0333"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09916"
FT                   /db_xref="InterPro:IPR024976"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXI0"
FT                   /protein_id="AAF09916.1"
FT                   /translation="MGLAGAVALSLFDELDVVFGPAALADALFYRHSPALRFELEGGKT
FT                   YIAQFLQAVDRARTVLNVAFAGMEAVTAVLGVWGDDPPAQLWATAEAALHELGIKLPAP
FT                   ELSASELPTPETRVLHGEEDTQVLFAFTLSTARLPELLWGSLAADLGIFPQLRGRLWLA
FT                   APELGLLACPYDSRGMDMIGPNTARLAQLYHQFGDWLLDHDRARMAEMLSPGSKKP"
     MGLAGAVALS LFDELDVVFG PAALADALFY RHSPALRFEL EGGKTYIAQF LQAVDRARTV        60
     LNVAFAGMEA VTAVLGVWGD DPPAQLWATA EAALHELGIK LPAPELSASE LPTPETRVLH       120
     GEEDTQVLFA FTLSTARLPE LLWGSLAADL GIFPQLRGRL WLAAPELGLL ACPYDSRGMD       180
     MIGPNTARLA QLYHQFGDWL LDHDRARMAE MLSPGSKKP                              219
//

If you have problems or comments...

PBIL Back to PBIL home page