(data stored in ACNUC30630 zone)

EMBL: AE000513.PE33

AE000513.PE33        Location/Qualifiers
FT   CDS             34348..34695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0034"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09632"
FT                   /db_xref="InterPro:IPR025438"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYB6"
FT                   /protein_id="AAF09632.1"
FT                   /translation="MRSTPLMPTIRTAADLGLRLRTAADIPDLIGAAYGADSVILHADD
FT                   LAPEFLDLRSGLLGELFQKATNYRLPLALVLADTDAYGPRFSELALEHRQHPLICFFDS
FT                   EEAARAWLERV"
     MRSTPLMPTI RTAADLGLRL RTAADIPDLI GAAYGADSVI LHADDLAPEF LDLRSGLLGE        60
     LFQKATNYRL PLALVLADTD AYGPRFSELA LEHRQHPLIC FFDSEEAARA WLERV            115
//

If you have problems or comments...

PBIL Back to PBIL home page