(data stored in ACNUC30630 zone)

EMBL: AE000513.PE343

AE000513.PE343       Location/Qualifiers
FT   CDS             356849..357157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0355"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09945"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXF8"
FT                   /protein_id="AAF09945.1"
FT                   /translation="MADIKFMNESDGQEFQMTHPKAARVLQDIRAWAAGNDFSRVVFWR
FT                   DADDAHKLWVQLGDDRLNYWIHDSTFTEGKHETVEMQMDYARGAQRRSAAGFGKFDK"
     MADIKFMNES DGQEFQMTHP KAARVLQDIR AWAAGNDFSR VVFWRDADDA HKLWVQLGDD        60
     RLNYWIHDST FTEGKHETVE MQMDYARGAQ RRSAAGFGKF DK                          102
//

If you have problems or comments...

PBIL Back to PBIL home page