(data stored in ACNUC30630 zone)

EMBL: AE000513.PE362

AE000513.PE362       Location/Qualifiers
FT   CDS             374541..374843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000666 percent identity: 62.30;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09953"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXD9"
FT                   /protein_id="AAF09953.1"
FT                   /translation="MARVPHTSPHTRAVLAALLAAYPAHRYGYDLSKQTELKSGTLYPI
FT                   LQRLHEQGYLVAEWEASPHAGKPPRHIYRLTEDGLRLAREQRGENQRLRLKGALA"
     MARVPHTSPH TRAVLAALLA AYPAHRYGYD LSKQTELKSG TLYPILQRLH EQGYLVAEWE        60
     ASPHAGKPPR HIYRLTEDGL RLAREQRGEN QRLRLKGALA                             100
//

If you have problems or comments...

PBIL Back to PBIL home page