(data stored in ACNUC30630 zone)

EMBL: AE000513.PE381

AE000513.PE381       Location/Qualifiers
FT   CDS             394911..395996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to SP:P43531 GB:U00096 PID:1742619
FT                   PID:1742630 PID:1787880 percent identity: 51.25; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09973"
FT                   /db_xref="GOA:Q9RXC0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXC0"
FT                   /protein_id="AAF09973.1"
FT                   /translation="MPLLAREFGLSTATVGTAIGSTTLAIALASPVAGLLADAFGRRRV
FT                   MLWAFALLLLPCLGAVYASSFTALNVARFAQGLLIPLVSVAITAYLAEETPPGTLGRYM
FT                   SAYISGTVLGGFLGRFASGLVAHGGQWHTAFWLLMVTNALGFWAVWRLPRSGGFRPAVD
FT                   AQETMRTLREHLRNPRLLTVCVVGFLILFVLVSVFNTVTFRLAAAPYSLGSGPLGAVFT
FT                   VYLLGVVVTPASAPLAARLGTARTLVVASGLSLLGLALTLSTALPVIVLGLAAASSGIF
FT                   IAQAAAQSAVQQSVQGGRSLAGGLYNMTYYAGAAAASVAAGLTYDAGGWRAVVGLCALA
FT                   LLAVAGLSTVVGRRQRRAEAG"
     MPLLAREFGL STATVGTAIG STTLAIALAS PVAGLLADAF GRRRVMLWAF ALLLLPCLGA        60
     VYASSFTALN VARFAQGLLI PLVSVAITAY LAEETPPGTL GRYMSAYISG TVLGGFLGRF       120
     ASGLVAHGGQ WHTAFWLLMV TNALGFWAVW RLPRSGGFRP AVDAQETMRT LREHLRNPRL       180
     LTVCVVGFLI LFVLVSVFNT VTFRLAAAPY SLGSGPLGAV FTVYLLGVVV TPASAPLAAR       240
     LGTARTLVVA SGLSLLGLAL TLSTALPVIV LGLAAASSGI FIAQAAAQSA VQQSVQGGRS       300
     LAGGLYNMTY YAGAAAASVA AGLTYDAGGW RAVVGLCALA LLAVAGLSTV VGRRQRRAEA       360
     G                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page