(data stored in ACNUC30630 zone)

EMBL: AE000513.PE383

AE000513.PE383       Location/Qualifiers
FT   CDS             396838..398931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0397"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="similar to GB:AL009126 percent identity: 57.19;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09974"
FT                   /db_xref="GOA:Q9RXB8"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR037920"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXB8"
FT                   /protein_id="AAF09974.1"
FT                   /translation="MIEWPRDAELWPTVPAPPPYPPPMTATRDVLLTCPLDCPDACRLK
FT                   ITIERQPDGSEKAVKLTGDPAHPYTRGFACAKTVHYPARQNHPERPLYPLRRVNPKTDP
FT                   EPQWERVTWDEALDDIAGRLRQLIAERGPQSILPYHYAGNMGLLEGSHVHALWRALGAA
FT                   ELEETICASAGTAAWEVGYGTRLAVDPLDVPHARLIVLWGINSLSTHSHLTPQITAARK
FT                   NGARVVCVDPYRNRTAAFADEHLKIRPGTDAALALGVMRELFVNGWTDAEYLAQATEGV
FT                   DDLRAAAEEWSPQRTAEVTGLTADEVRDFARLIGTTRPTYIRVGYGMTRYENGATALRA
FT                   VTLLPALTGDWRYRGGGCVMSTSGTFKLNRRRLGAAHVTRPEAPRVNMNELANALDPAV
FT                   GFGALFVYNCNPAVVSPDSGRVRAGMRRDDLLVVVLEQAMTESARLADYVLPATTFMES
FT                   PDLYTSYGHFWLGYNPAELTPPGECRPNSWVFAELARRLGVEEPSVYWTADDLMAELLD
FT                   TDHPFLDGLTPERLKAEGTVRLNVPDGFLPYAYGAETPSGKVQLAPAPRFVPVQAELNA
FT                   DFPLRLLTPPAHHFLNSTYGNLGNLNRAEGGEPQVLLCPADAAASGVQDGEYARLTSEQ
FT                   GEVRRRVKVTDAAQPGVAVVEGTWWGLTAPDGRSINELTAQTLTDLGGGSTFHNTRIRV
FT                   SPA"
     MIEWPRDAEL WPTVPAPPPY PPPMTATRDV LLTCPLDCPD ACRLKITIER QPDGSEKAVK        60
     LTGDPAHPYT RGFACAKTVH YPARQNHPER PLYPLRRVNP KTDPEPQWER VTWDEALDDI       120
     AGRLRQLIAE RGPQSILPYH YAGNMGLLEG SHVHALWRAL GAAELEETIC ASAGTAAWEV       180
     GYGTRLAVDP LDVPHARLIV LWGINSLSTH SHLTPQITAA RKNGARVVCV DPYRNRTAAF       240
     ADEHLKIRPG TDAALALGVM RELFVNGWTD AEYLAQATEG VDDLRAAAEE WSPQRTAEVT       300
     GLTADEVRDF ARLIGTTRPT YIRVGYGMTR YENGATALRA VTLLPALTGD WRYRGGGCVM       360
     STSGTFKLNR RRLGAAHVTR PEAPRVNMNE LANALDPAVG FGALFVYNCN PAVVSPDSGR       420
     VRAGMRRDDL LVVVLEQAMT ESARLADYVL PATTFMESPD LYTSYGHFWL GYNPAELTPP       480
     GECRPNSWVF AELARRLGVE EPSVYWTADD LMAELLDTDH PFLDGLTPER LKAEGTVRLN       540
     VPDGFLPYAY GAETPSGKVQ LAPAPRFVPV QAELNADFPL RLLTPPAHHF LNSTYGNLGN       600
     LNRAEGGEPQ VLLCPADAAA SGVQDGEYAR LTSEQGEVRR RVKVTDAAQP GVAVVEGTWW       660
     GLTAPDGRSI NELTAQTLTD LGGGSTFHNT RIRVSPA                                697
//

If you have problems or comments...

PBIL Back to PBIL home page