(data stored in ACNUC30630 zone)

EMBL: AE000513.PE387

AE000513.PE387       Location/Qualifiers
FT   CDS             complement(404533..405204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0401"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09984"
FT                   /db_xref="GOA:Q9RXB4"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXB4"
FT                   /protein_id="AAF09984.1"
FT                   /translation="MSANSHQDQPPRARIDGEVVGLLLLVVAFLLGLVLLLPFLGHQGG
FT                   ALVGARRALLDWAGWLAWLLPVAALAYGVATFINASLRELTRWVLGGLLAVFAVLCLQA
FT                   FFLPGQPGHPSTAGLLADGLAGKLRPVLGPATPLLLLFAALIGLKIMLGVSLLGVTRRL
FT                   VHGLIGLLTGVGHNVQGAIEARLPGNGTVVAHNRTDVRGQLSELRGHLDAYGASTPKTS
FT                   G"
     MSANSHQDQP PRARIDGEVV GLLLLVVAFL LGLVLLLPFL GHQGGALVGA RRALLDWAGW        60
     LAWLLPVAAL AYGVATFINA SLRELTRWVL GGLLAVFAVL CLQAFFLPGQ PGHPSTAGLL       120
     ADGLAGKLRP VLGPATPLLL LFAALIGLKI MLGVSLLGVT RRLVHGLIGL LTGVGHNVQG       180
     AIEARLPGNG TVVAHNRTDV RGQLSELRGH LDAYGASTPK TSG                         223
//

If you have problems or comments...

PBIL Back to PBIL home page