(data stored in ACNUC30630 zone)

EMBL: AE000513.PE401

AE000513.PE401       Location/Qualifiers
FT   CDS             complement(416044..417564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0415"
FT                   /product="carboxylesterase, putative"
FT                   /note="similar to GP:2641986 percent identity: 52.63;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09993"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXA0"
FT                   /protein_id="AAF09993.1"
FT                   /translation="MKRWLAWTALTLGGLAQAAAPQLRVEQGTLNGKAVNSVQQFLGVP
FT                   FAAPPVGPLRWQPPQPPVWSGQRDATQFGPACAQGDGGSEDCLTLNIYRPPNAKNAPLL
FT                   VWVHGGFFTGGDASLFDGSALARERGVVVATVNYRLGLYGFLAVPGVTDGNAGLYDILG
FT                   AVRWLKQNAASIGADPGNITLAGQSAGAAAICTLLAAPSAAGLFQKAILQSGSCAAPIF
FT                   QTPLGDARRKGELFSRALRCDRGETATCLRGKSRAELDGVRLTGRGPVDPVPLPPVYGD
FT                   ALIPLRPQDAFAQGQSLKVAVMLGINREEGQIFEPYLPDLLRGSRTLYRAGLTLINPLQ
FT                   AWALGGRYPLRSDEQPIRAVTRLLTDQVFACPTSWLAGKLGAGLPTYFYEFSDPRPPLQ
FT                   LAGKVNVPNLGAYHGAELAYVLDTPVVGVSDPAQFSSAQAKLAAQMGEYWTNFARSGQP
FT                   ASLGLTVWPTFNPAFPQVMTLEPGATALKPNFDGRHQCDYWNGAEGRR"
     MKRWLAWTAL TLGGLAQAAA PQLRVEQGTL NGKAVNSVQQ FLGVPFAAPP VGPLRWQPPQ        60
     PPVWSGQRDA TQFGPACAQG DGGSEDCLTL NIYRPPNAKN APLLVWVHGG FFTGGDASLF       120
     DGSALARERG VVVATVNYRL GLYGFLAVPG VTDGNAGLYD ILGAVRWLKQ NAASIGADPG       180
     NITLAGQSAG AAAICTLLAA PSAAGLFQKA ILQSGSCAAP IFQTPLGDAR RKGELFSRAL       240
     RCDRGETATC LRGKSRAELD GVRLTGRGPV DPVPLPPVYG DALIPLRPQD AFAQGQSLKV       300
     AVMLGINREE GQIFEPYLPD LLRGSRTLYR AGLTLINPLQ AWALGGRYPL RSDEQPIRAV       360
     TRLLTDQVFA CPTSWLAGKL GAGLPTYFYE FSDPRPPLQL AGKVNVPNLG AYHGAELAYV       420
     LDTPVVGVSD PAQFSSAQAK LAAQMGEYWT NFARSGQPAS LGLTVWPTFN PAFPQVMTLE       480
     PGATALKPNF DGRHQCDYWN GAEGRR                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page